Cagrilintide
Research Compound · 1 vial x 10mg
$121
| Pack size | 1 vial x 10mg |
| Also known as | AM833, NN0174-0833 |
| Compound type | Acylated peptide; amylin and calcitonin receptor agonist |
| Sequence | (C20 diacid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409.1 g/mol |
| CAS number | 1415456-99-3 |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
Cagrilintide is a long-acting, acylated analog of the hormone amylin. It binds the amylin 3 receptor and the calcitonin receptor with picomolar affinity and has a low tendency to form amyloid fibrils. It has also been studied in combination with semaglutide.
Research areas
- Amylin and calcitonin receptor pharmacology
- Amylin analog design
- Combination studies with GLP-1 agonists
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.