Cagrisema (2.5mg+2.5mg)
Research Compound · 1 vial x 5mg
$46
| Pack size | 1 vial x 5mg |
| Contents | 2.5mg cagrilintide + 2.5mg semaglutide per vial |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
This vial combines Cagrilintide and Semaglutide (2.5mg cagrilintide + 2.5mg semaglutide per vial).
Cagrilintide
Cagrilintide is a long-acting, acylated analog of the hormone amylin. It binds the amylin 3 receptor and the calcitonin receptor with picomolar affinity and has a low tendency to form amyloid fibrils. It has also been studied in combination with semaglutide.
| Also known as | AM833, NN0174-0833 |
| Compound type | Acylated peptide; amylin and calcitonin receptor agonist |
| Sequence | (C20 diacid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409.1 g/mol |
| CAS number | 1415456-99-3 |
Semaglutide
Semaglutide is a synthetic analog of glucagon-like peptide-1 (GLP-1). The lysine at position 20 carries a C18 fatty diacid on a γ-glutamate and two-OEG linker, which binds serum albumin and greatly extends its half-life, and an Aib substitution at position 2 protects it from DPP-4 cleavage. It is used in research on GLP-1 receptor signaling and receptor pharmacology.
| Compound type | Lipidated peptide; GLP-1 receptor agonist |
| Sequence | H-Aib-EGTFTSDVSSYLEGQAA-K(γGlu-2×OEG-C18 diacid)-EFIAWLVRGRG |
| Molecular formula | C187H291N45O59 |
| Molecular weight | 4113.6 g/mol |
| CAS number | 910463-68-2 |
Research areas
- Amylin and calcitonin receptor pharmacology
- Amylin analog design
- Combination studies with GLP-1 agonists
- GLP-1 receptor pharmacology
- Incretin receptor signaling
- Long-acting peptide design
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.