IGF-1 LR3
Research Compound · 1 vial x 100mcg
$27
| Pack size | 1 vial x 100mcg |
| Also known as | Long R3 IGF-1 |
| Compound type | Recombinant 83-amino-acid IGF-1 analog |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular weight | ≈9.1 kDa |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
IGF-1 LR3 is a long-acting analog of human insulin-like growth factor 1, made as a single 83-amino-acid chain. It was designed for mammalian cell culture, where it supports longer-lasting IGF-1 signaling than native IGF-1.
Research areas
- IGF-1 receptor signaling
- Cell proliferation in culture
- Growth-factor biology
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.