LL37
Research Compound · 1 vial x 5mg
$53
| Pack size | 1 vial x 5mg |
| Also known as | Human cathelicidin antimicrobial peptide |
| Compound type | 37-amino-acid antimicrobial peptide |
| Sequence | [LL-37, 37 aa] |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.3 g/mol |
| CAS number | 154947-66-7 |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
LL-37 is the 37-amino-acid, amphipathic antimicrobial peptide derived from human cathelicidin. Besides direct antimicrobial activity, it is a ligand of formyl peptide receptor-like 1 (FPRL1/FPR2), through which it mobilizes calcium and attracts human neutrophils and monocytes.
Research areas
- Innate immunity
- Antimicrobial peptide mechanisms
- FPR2 signaling and chemotaxis
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.