Retatrutide 5mg+cagrilintide 5mg
Research Compound · 1 vial x 10mg
$84
| Pack size | 1 vial x 10mg |
| Contents | 5mg retatrutide + 5mg cagrilintide per vial |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
This vial combines Retatrutide and Cagrilintide (5mg retatrutide + 5mg cagrilintide per vial).
Retatrutide
Retatrutide is a single peptide that activates three receptors: the glucagon receptor, the GLP-1 receptor, and the GIP receptor. In cells expressing each human receptor it drives cAMP accumulation, and a C20 fatty diacid side chain extends its circulation time. It is studied as a tool for comparing combined incretin and glucagon receptor signaling in cell-based assays.
| Also known as | LY3437943 |
| Compound type | Lipidated peptide; GIP / GLP-1 / glucagon receptor triple agonist |
| Sequence | Y-Aib-QGTFTSDYSI-αMeL-LDK-K(AEEA-γGlu-C20 diacid)-AQ-Aib-AFIEYLLEGGPSSGAPPPS-NH2 |
| Molecular formula | C221H342N46O68 |
| Molecular weight | 4731.4 g/mol |
| CAS number | 2381089-83-2 |
Cagrilintide
Cagrilintide is a long-acting, acylated analog of the hormone amylin. It binds the amylin 3 receptor and the calcitonin receptor with picomolar affinity and has a low tendency to form amyloid fibrils. It has also been studied in combination with semaglutide.
| Also known as | AM833, NN0174-0833 |
| Compound type | Acylated peptide; amylin and calcitonin receptor agonist |
| Sequence | (C20 diacid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409.1 g/mol |
| CAS number | 1415456-99-3 |
Research areas
- Glucagon, GLP-1, and GIP receptor signaling
- cAMP signaling assays
- Multi-receptor agonist design
- Amylin and calcitonin receptor pharmacology
- Amylin analog design
- Combination studies with GLP-1 agonists
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.