Sermorelin Acetate
Research Compound
$38
| Pack size | 1 vial, size selected above |
| Also known as | GRF (1-29)-NH2; human growth hormone-releasing factor (1-29) amide |
| Compound type | Synthetic 29-amino-acid GHRH fragment |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Molecular formula | C149H246N44O42S |
| Molecular weight | 3357.9 g/mol |
| CAS number | 86168-78-7 |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
Sermorelin is the amidated 1–29 fragment of human growth hormone-releasing hormone (somatoliberin), the shortest fully active portion of the hormone. It is used in endocrine research on GHRH receptor signaling and pituitary growth hormone release, and it is the parent sequence from which Modified GRF (1-29) was derived.
Supplied as the acetate salt.
Research areas
- GHRH receptor signaling
- Pituitary growth hormone release
- GHRH analog design
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.