VIP
Research Compound
$49
| Pack size | 1 vial, size selected above |
| Also known as | Vasoactive intestinal peptide |
| Compound type | 28-amino-acid neuropeptide |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Molecular formula | C147H238N44O42S |
| Molecular weight | 3325.8 g/mol |
| CAS number | 40077-57-4 |
| Form | Lyophilized powder |
| Purity | 99% Pure |
| Storage | Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol. |
| Intended use | Laboratory research only |
This product is sold exclusively for laboratory research use by qualified professionals and institutions. It is not a drug, food, cosmetic, or dietary supplement, and is not approved for use in humans or animals. Handling must be performed only by trained personnel in a controlled research setting.
Research overview
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide and gastrointestinal hormone related to glucagon and secretin. It is studied in research on neuroendocrine and immune signaling, smooth-muscle relaxation, and circadian regulation.
Research areas
- VPAC receptor signaling
- Neuroimmune regulation
- Gastrointestinal physiology
Sources
Handling and storage
Store lyophilized powder at -20°C. Once reconstituted, refrigerate at 2-8°C and use within the timeframe indicated by your lab protocol.